IGF-1 LR3 is a single chain of polypeptides which consists of 83 amino acids. The growth factor IGF1 has many other effects which helps promoting growth and development in growth hormone(GH;MIM 139250). There is a long term analog of IGF-1 human growth factor i-e LR3, which is responsible for support of recombinant bio-pharmaceuticals manufacture at large.
Long R3 IGF-1 is more potent than the normal factor IGF-1. The presence of biological activities in these protein bindings, cause increase in potency and increase the function of IG-1 LR3.The purpose of creation of this IGF-1 LR3 analog of IGF-1 is to increase IGF peptide in biological activities. The growth factor IGF1 LR3 is also termed as Long R3 IGF-1 or Insulin-Like Growth Factor-I Long Arg3.
The growth factor IGF-1LR3 is responsible for the cells response to growth hormone(G:H) which means that at first IGF is developed by responding to GH and then cellular movements are brought through IGF later on. Development of hyperplasia muscles growth is an example of this process. This compound is responsible for more sensitiveness of human body to insulin. This factor is the most potent and influential growth factor which human body carries. The term “Muscle Cell Hyperplasia” is the process of forming new cells as well as cell splitting by IGF 1. IGF-1 LR3 is the strongest and effective form of IGF-1. Many chemical alterations have been applied on this formula for limiting the proteins from binding in human body and for increasing the half life up to 20-30 hour.
Chemical Composition of IGF 1 LR3
The actual composition of analog of IGF-1(83 amino acid) i-e Polypeptide Long R3 Insulin-Like Growth Factor-1 (IGF1 LR3), is a complete sequence of IGF-1. Although at position 3, Arginine (Arg) substitutes the Glumetic Acid (Glu) along with an extension peptide of 13 amino acid. The effect of this sequence takes place in such a way that it prohibits protein binding in IGF-1 LR3 and thus allowing it 20 to 30 hours more half life duration.
IGF 1 LR3 Interactions
The behavior of an active IGF differs in different types of tissues. It stimulates protein and associated cell components in muscle cells and as a result amino acid absorption occurs and protein synthesis increases. For adipose tissues, IGF-1 LR3 acts as energy source by mobilizing fat for using it as energy. It prohibits insulin from carrying glucose to cell membrane in lean tissues and furthermore making the cell to use and burn fat for energy production.
The promotional effect of IGF-1 LR3 in retention of nitrogen and protein synthesis builds new muscle tissues. Due to this effect, the muscles grow through both processes i-e Hyperplasia & Mitogenesis. Hyperlasia. The first refers increase in the number of muscle cells & and the later represents actual growth of muscle fibers. Genetic capabilities can actually change by IGF in the form of muscle tissues and cell count.
IGF-1 LR3 1mg
$56.99
Buy IGF-1 LR3 Online Today at Enhanced Peptides. Fast Shipping from the USA. Over 100 High Quality Peptides and Research Chemicals for sale.
Description
IGF 1 LR3
Also known as Insulin Growth Factor 1 Long R3
IGF-1 LR3 is a single chain of polypeptides which consists of 83 amino acids. The growth factor IGF1 has many other effects which helps promoting growth and development in growth hormone(GH;MIM 139250). There is a long term analog of IGF-1 human growth factor i-e LR3, which is responsible for support of recombinant bio-pharmaceuticals manufacture at large.
Chemical Description of IGF LR3
Chemical Structure:
Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA
Molar Mass: 9,111 Da
Synonyms:Long R3 IGF-1, IGF-1 LR3 (Long R3 IGF-1), LR3 IGF, IGF1 LR3, Long Arg3 IGF-1
Long R3 IGF-1 is more potent than the normal factor IGF-1. The presence of biological activities in these protein bindings, cause increase in potency and increase the function of IG-1 LR3.The purpose of creation of this IGF-1 LR3 analog of IGF-1 is to increase IGF peptide in biological activities. The growth factor IGF1 LR3 is also termed as Long R3 IGF-1 or Insulin-Like Growth Factor-I Long Arg3.
The growth factor IGF-1LR3 is responsible for the cells response to growth hormone(G:H) which means that at first IGF is developed by responding to GH and then cellular movements are brought through IGF later on. Development of hyperplasia muscles growth is an example of this process. This compound is responsible for more sensitiveness of human body to insulin. This factor is the most potent and influential growth factor which human body carries. The term “Muscle Cell Hyperplasia” is the process of forming new cells as well as cell splitting by IGF 1. IGF-1 LR3 is the strongest and effective form of IGF-1. Many chemical alterations have been applied on this formula for limiting the proteins from binding in human body and for increasing the half life up to 20-30 hour.
Chemical Composition of IGF 1 LR3
The actual composition of analog of IGF-1(83 amino acid) i-e Polypeptide Long R3 Insulin-Like Growth Factor-1 (IGF1 LR3), is a complete sequence of IGF-1. Although at position 3, Arginine (Arg) substitutes the Glumetic Acid (Glu) along with an extension peptide of 13 amino acid. The effect of this sequence takes place in such a way that it prohibits protein binding in IGF-1 LR3 and thus allowing it 20 to 30 hours more half life duration.
IGF 1 LR3 Interactions
The behavior of an active IGF differs in different types of tissues. It stimulates protein and associated cell components in muscle cells and as a result amino acid absorption occurs and protein synthesis increases. For adipose tissues, IGF-1 LR3 acts as energy source by mobilizing fat for using it as energy. It prohibits insulin from carrying glucose to cell membrane in lean tissues and furthermore making the cell to use and burn fat for energy production.
The promotional effect of IGF-1 LR3 in retention of nitrogen and protein synthesis builds new muscle tissues. Due to this effect, the muscles grow through both processes i-e Hyperplasia & Mitogenesis. Hyperlasia. The first refers increase in the number of muscle cells & and the later represents actual growth of muscle fibers. Genetic capabilities can actually change by IGF in the form of muscle tissues and cell count.
To learn more about this peptide, click here.
Buy IGF LR3 today at Enhanced Peptides
Additional information
Related Products
GHRP 2 5mg
$22.99 Add to cartCJC No DAC and Ipamorelin 5mg
$62.99 Add to cartAOD 9604 5mg
$36.99 Add to cart